PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG031644t1
Common NameTCM_031644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 174aa    MW: 20296 Da    PI: 9.3367
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG031644t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-171467356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      ++ ++++eq++ Le+ F  n+++  e + +LA++lg++ rqV +W+qN+Ra++k
  Thecc1EG031644t1 14 NKKRLNQEQVRLLEKSFTANKKLEPELKLHLANQLGVPPRQVAIWYQNKRARWK 67
                      56789************************************************9 PP

2HD-ZIP_I/II108.54.7e-3514105293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       +k+rl++eqv+lLE+sF++++kLepe K +la++Lg+ prqva+W+qn+RAR+kt+ lE dy++L+ ++++  +e++rLek+v+ L+eel++
  Thecc1EG031644t1  14 NKKRLNQEQVRLLEKSFTANKKLEPELKLHLANQLGVPPRQVAIWYQNKRARWKTQSLELDYNTLQVKLENALSEKRRLEKDVKYLQEELRK 105
                       79**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.613969IPR001356Homeobox domain
SMARTSM003892.8E-151173IPR001356Homeobox domain
SuperFamilySSF466892.65E-171178IPR009057Homeodomain-like
CDDcd000868.09E-131270No hitNo description
PfamPF000465.8E-151467IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-181676IPR009057Homeodomain-like
PROSITE patternPS0002704467IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MDFHGQKLYA PKHNKKRLNQ EQVRLLEKSF TANKKLEPEL KLHLANQLGV PPRQVAIWYQ  60
NKRARWKTQS LELDYNTLQV KLENALSEKR RLEKDVKYLQ EELRKAQEMM FAMNNYQKDH  120
HHRHPPFVSC TSAGSSEEGG SSSFREDNVH DHAVLQIDEL YACLIGADRP TWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6164391e-93JX616439.1 Gossypium hirsutum clone NBRI_GE61116 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021591.11e-129Homeobox-leucine zipper protein ATHB-52, putative
SwissprotQ9FN298e-44ATB52_ARATH; Homeobox-leucine zipper protein ATHB-52
TrEMBLA0A061F7W11e-129A0A061F7W1_THECC; Homeobox-leucine zipper protein ATHB-52, putative
STRINGPOPTR_0011s11510.12e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121072632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.12e-44homeobox protein 52
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]